Protein Info for Echvi_0215 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phosphomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase" amino acids 11 to 266 (256 residues), 325 bits, see alignment E=1.4e-101 PF08543: Phos_pyr_kin" amino acids 18 to 264 (247 residues), 318.3 bits, see alignment E=3.3e-99 PF00294: PfkB" amino acids 109 to 240 (132 residues), 36.1 bits, see alignment E=4.7e-13

Best Hits

Swiss-Prot: 51% identical to THID_RHIME: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 60% identity to aaa:Acav_2215)

MetaCyc: 46% identical to bacimethrin diphosphokinase (Clostridium botulinum A str. ATCC 19397)
2.7.6.-

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7)" (EC 2.7.4.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUU7 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Echvi_0215 phosphomethylpyrimidine kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNDKIKTYLPVLTIAGSDSGGGAGIQADLKTFSALGCFGTSVITATTAQNTQGVRSIHDI
PEQHIQDQLEAVLSDIGPKAIKIGMINRPEVVRVIVEALRRYPDIPVVFDPVMVATSGDR
LIKEETVEVIKQELFPVSNVITPNMDEAAVLIGKAVNDPQEMEKAAQTLLGYGSGFVLVK
GGHLQGDQVSDVLCGDGQTHVFESAKIKTKNVHGTGCTLSSAIAVFLAEGQEVRQAVASA
RNYVFQAIDAGKAVKTGQGSGPLNHFYYPKKMIIHELDQ