Protein Info for Echvi_0215 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phosphomethylpyrimidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00097: hydroxymethylpyrimidine kinase/phosphomethylpyrimidine kinase
  • amino acids 11 to 266 (256 residues), 325 bits, E=1.4e-101
• PF08543: Phos_pyr_kin
  • amino acids 18 to 264 (247 residues), 319.2 bits, E=1.7e-99
• PF00294: PfkB
  • amino acids 109 to 240 (132 residues), 37.3 bits, E=2e-13

Best Hits

Swiss-Prot: 51% identical to THID_RHIME: Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase (thiD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00941, hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC: 2.7.1.49 2.7.4.7] (inferred from 60% identity to aaa:Acav_2215)

MetaCyc: 46% identical to bacimethrin diphosphokinase (Clostridium botulinum A str. ATCC 19397)
2.7.6.-

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate kinase ThiD (EC 2.7.4.7)" (EC 2.7.4.7)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• thiamine diphosphate salvage II (5/5 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate salvage IV (yeast) (6/7 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis I (2/2 steps found)
• hydroxymethylpyrimidine salvage (2/2 steps found)
• thiamine diphosphate formation from pyrithiamine and oxythiamine (yeast) (5/8 steps found)
• superpathway of thiamine diphosphate biosynthesis III (eukaryotes) (4/7 steps found)
• bacimethrin and bacimethrin pyrophosphate biosynthesis (1/4 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (2/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.49 or 2.7.4.7

Sequence Analysis Tools

See L0FUU7 at UniProt or InterPro

Protein Sequence (279 amino acids)

>Echvi_0215 phosphomethylpyrimidine kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNDKIKTYLPVLTIAGSDSGGGAGIQADLKTFSALGCFGTSVITATTAQNTQGVRSIHDI
PEQHIQDQLEAVLSDIGPKAIKIGMINRPEVVRVIVEALRRYPDIPVVFDPVMVATSGDR
LIKEETVEVIKQELFPVSNVITPNMDEAAVLIGKAVNDPQEMEKAAQTLLGYGSGFVLVK
GGHLQGDQVSDVLCGDGQTHVFESAKIKTKNVHGTGCTLSSAIAVFLAEGQEVRQAVASA
RNYVFQAIDAGKAVKTGQGSGPLNHFYYPKKMIIHELDQ