Protein Info for Echvi_0182 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Mg2+ transporter (mgtE)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 290 to 311 (22 residues), see Phobius details amino acids 320 to 343 (24 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details amino acids 392 to 418 (27 residues), see Phobius details amino acids 430 to 453 (24 residues), see Phobius details TIGR00400: magnesium transporter" amino acids 17 to 454 (438 residues), 346.8 bits, see alignment E=9.2e-108 PF03448: MgtE_N" amino acids 37 to 137 (101 residues), 75.5 bits, see alignment E=6.6e-25 PF00571: CBS" amino acids 204 to 259 (56 residues), 39.8 bits, see alignment 7e-14 PF01769: MgtE" amino acids 324 to 448 (125 residues), 113.1 bits, see alignment E=1.6e-36

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 60% identity to mtt:Ftrac_3194)

Predicted SEED Role

"Mg/Co/Ni transporter MgtE / CBS domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FRB6 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Echvi_0182 Mg2+ transporter (mgtE) (Echinicola vietnamensis KMM 6221, DSM 17526)
MEKIREFELSREYLESLKVSIEEENISGIRESLEGTNEADVASLLDELEMEEVLYVLRVL
EHEFAADVLIELDEESQFKLVQEMESEELALLLDSMESDDAVDILHQLVVKDREDVISHL
QEKEKAGHIMELLRYEEGSAGALMAKEFIKANLNWTVVQTIDEIRRQAENVEKIYSIYVV
DNKESLLGRVALKKIILGSANTKIKDIFEEDIISVPTYMDEEEIAEIMRKYDLEALPVVN
AKNKLVGRITVDDVLDVIREQAEEDMQAMTGISDDVEESDSVFRLSKARLPWLLIGIFGG
LMGARIIGVFNDGLSKYIQLASFIPLITATGGNVGIQSSSLVVQSLAAKSVFAESIGKRF
AKVLLVAMLNGIVLGAVVFGTVVFVYGNEVKFGIVVGFALFSVVLLASFMGTVTPIVLDK
FGINPAMASGPFITTANDLLGLAVYFLVAMMLLNL