Protein Info for Echvi_0180 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: transcription elongation factor GreA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 PF03449: GreA_GreB_N" amino acids 6 to 75 (70 residues), 93 bits, see alignment E=1.1e-30 TIGR01462: transcription elongation factor GreA" amino acids 7 to 155 (149 residues), 176.9 bits, see alignment E=1.4e-56 PF01272: GreA_GreB" amino acids 83 to 157 (75 residues), 85.1 bits, see alignment E=2.6e-28

Best Hits

Swiss-Prot: 65% identical to GREA_FLAJ1: Transcription elongation factor GreA (greA) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K03624, transcription elongation factor GreA (inferred from 73% identity to dfe:Dfer_4815)

Predicted SEED Role

"Transcription elongation factor GreA" in subsystem Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FT59 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Echvi_0180 transcription elongation factor GreA (Echinicola vietnamensis KMM 6221, DSM 17526)
MGQVQYYTEEGLKKLKDELQELKTKGRQDIAKQIAEARDKGDLSENAEYDAAKDAQGLLE
LKIAKLEGVIGNARVLDNSKMDTSKVGILCTVKIKNVKNGMTVAYTLVSEEEADLKANKI
SLASPFGKGLLGKKVGEIAQINAPAGVVEFEVLDITY