Protein Info for Echvi_0168 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Uncharacterized homolog of PSP1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF04468: PSP1" amino acids 113 to 197 (85 residues), 108 bits, see alignment E=3.8e-35 PF28472: PSP1_3rd" amino acids 227 to 269 (43 residues), 77.5 bits, see alignment 6.4e-26 PF28473: YaaT_C" amino acids 279 to 323 (45 residues), 74 bits, see alignment 9.5e-25

Best Hits

KEGG orthology group: None (inferred from 57% identity to lby:Lbys_3362)

Predicted SEED Role

"Signal peptidase-like protein" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUW1 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Echvi_0168 Uncharacterized homolog of PSP1 (Echinicola vietnamensis KMM 6221, DSM 17526)
MAGCSSCSTTTGGGGCQNNGSCGTSDCNKMNSFDWLSHMGIPNVDNFDIVEVKFKGGRKD
YFRNVNHLQLTTGDPVVVDVPSGHHIGYVSLQGELVRLQMQKRKIKNDDNITKIYRVASP
KDLEKWEEAKNREIPTLYRTKQIIDEIKLEMKLSDIEYQADNSKATFYYSADERVDFREL
IKILASEFKIRVEMRQISLRQEAGRLGGIGVCGRELCCSTWIHDFKSVSTSAARYQNLSL
NPTKLSGQCGRLKCCLNYELDTYMTALEDIPTIEKPLVTEAGHAKLQKTDIFRKLMWFSY
NNENNWHSIDCDRVKEIIEMNKEGKKPFSLELNDVMDLEEEKSNSNIDLELLDKKFSKNN
KKRKKRKPRQKQPSNRSAAGAKTNTPPPNKDQKDRQQHTRRKPSNRRKGGEQRKGQSPPK
QQPSTDQNNPQASQGAKPKGNKRRNNRRKGGGRPSNNKGNQQNDQ