Protein Info for Echvi_0167 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02844: GARS_N
  • amino acids 1 to 104 (104 residues), 120.3 bits, E=1.3e-38
• TIGR00877: phosphoribosylamine--glycine ligase
  • amino acids 1 to 426 (426 residues), 466.4 bits, E=4.2e-144
• PF01071: GARS_A
  • amino acids 105 to 299 (195 residues), 225.5 bits, E=1.4e-70
• PF02786: CPSase_L_D2
  • amino acids 108 to 197 (90 residues), 34.3 bits, E=4.5e-12
• PF02655: ATP-grasp_3
  • amino acids 140 to 294 (155 residues), 27 bits, E=1.1e-09
• PF02843: GARS_C
  • amino acids 334 to 423 (90 residues), 101.8 bits, E=5.5e-33

Best Hits

Swiss-Prot: 48% identical to PUR2_VIBCH: Phosphoribosylamine--glycine ligase (purD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 61% identity to mtt:Ftrac_3346)

MetaCyc: 47% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (4/5 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Sequence Analysis Tools

See L0FR95 at UniProt or InterPro

Protein Sequence (430 amino acids)

>Echvi_0167 phosphoribosylamine--glycine ligase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNILLLGSGGREHAFAYKIANSPKCDRLYVAPGNAGTASIATNVSIGITDFPALKDFILA
NAIDLVVVGPEEPLVKGVADYFASQEETKALPVVGPKQKGATLEGSKDFSKQFMQRHQVP
TAASATFTKDTIDEGLAFIRAQQVPVVLKADGLAAGKGVLICETIEDAESSFKEMLLESK
FGAASEKVVIEEFLSGIELSVFVATDGKSYKILPEAKDYKRIGEKDTGLNTGGMGAVSPV
PFAKGAFLKKVEEKVVKPTIEGLKKDEIDYKGFIFIGLMNDNGEPYVIEYNVRMGDPETQ
AVLPRIKSDFVDLLYAMGTGTLEDYDLELEDFTATTIVMVAGGYPGSYPKGDAISGLENE
DGASLTFHAGTTTNPQGDVVTNGGRILGITGKGNSIEEALSNAYSRVNEISWKDVYFRKD
IGQDVLNYGK