Protein Info for Echvi_0165 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: KpsF/GutQ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF01380: SIS" amino acids 41 to 171 (131 residues), 80.5 bits, see alignment E=9.7e-27 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 45 to 312 (268 residues), 322.5 bits, see alignment E=1.2e-100 PF00571: CBS" amino acids 201 to 256 (56 residues), 28.9 bits, see alignment E=1.2e-10 amino acids 267 to 319 (53 residues), 34.9 bits, see alignment 1.6e-12

Best Hits

Swiss-Prot: 43% identical to Y1546_AQUAE: Uncharacterized phosphosugar isomerase aq_1546 (aq_1546) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 64% identity to dfe:Dfer_3603)

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FT42 at UniProt or InterPro

Protein Sequence (322 amino acids)

>Echvi_0165 KpsF/GutQ family protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MNIIKNIRNSAIKVLQTEAEALQNLIPKIDGDFEACVEEILHSKGRVVITGVGKSAIVAT
KIVATLNSTGTPALFMHAADAIHGDLGMIQKEDFVLCISKSGNTPEVKVLVPMLKRMGSR
LVALVSNTDSYLAEHADFVLNATIAAEACPLNLAPTTSTTAHMAMGDALAVCLLEARGFS
SDDFARYHPGGALGKQLYLTVDDLMVKDAVPVVHESAALTEVILEISGKRLGATAVVDSS
RKLMGIVTDGDLRRMLENHQDLSKLTAKDIMTINPKTIVRNEYAVRALNRMREYNITQLV
VAEEGEVFGFIHIHDLMKEGIV