Protein Info for Echvi_0162 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Malate/L-lactate dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF02615: Ldh_2" amino acids 4 to 345 (342 residues), 420.5 bits, see alignment E=2.4e-130

Best Hits

KEGG orthology group: None (inferred from 75% identity to chu:CHU_0320)

Predicted SEED Role

"Putative malate dehydrogenase (EC 1.1.1.37), similar to archaeal MJ1425" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 1.1.1.37)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.37

Use Curated BLAST to search for 1.1.1.37

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FR90 at UniProt or InterPro

Protein Sequence (358 amino acids)

>Echvi_0162 Malate/L-lactate dehydrogenases (Echinicola vietnamensis KMM 6221, DSM 17526)
MNFDFKSLFAFTKEIFIKIGCPEADAQSATEVLLSADLRGVDSHGVARLSGYVRLWEAGR
INPTPKIRIVHETPSTAVVDGDGGLGLVVAPVAMKIAIEKAKNAGTGWVSVKNSNHYGIA
GHHALQAVKEDMIGMSMTNASPLVSPTFSKERLLGTNPISVAIPAGKEPPFVADMATTTA
ANGKLEILQRKQENAPSGWVQDKEGNPTTNAFGVKEGGALLPLGGDREHGSHKGYALGAI
VDIFSAVLSGANYGPWVPPFVAFLEPDPNPVGEGIGHFFGAMRVDAFRPADEFKNHMDTW
ISRFREAKTTPGHDKVLIPGDPERELEKERMENGIPLLEPVQQDLTALGEKFGVPLRS