Protein Info for Echvi_0155 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: ketose-bisphosphate aldolases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 PF01116: F_bP_aldolase" amino acids 3 to 272 (270 residues), 295.1 bits, see alignment E=2.9e-92 TIGR00167: ketose-bisphosphate aldolase" amino acids 5 to 270 (266 residues), 237.7 bits, see alignment E=8.6e-75

Best Hits

KEGG orthology group: K08302, tagatose 1,6-diphosphate aldolase [EC: 4.1.2.40] (inferred from 71% identity to dfe:Dfer_1705)

Predicted SEED Role

"Fructose-bisphosphate aldolase class II (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13 or 4.1.2.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FT32 at UniProt or InterPro

Protein Sequence (274 amino acids)

>Echvi_0155 ketose-bisphosphate aldolases (Echinicola vietnamensis KMM 6221, DSM 17526)
MKLKHKLQEFTAQKRGLLATNFYNLETLQGVLKAASAMDEPVILQLTKSSIDYMGLNTAV
AMGRAALKEYGVEGWIHLDHGGSVELAQACLDAGFDSVMIDGSELPFEENVKITQEVVRR
AHKYGANVEAELGYVAKLGQSHEHQGFTTAEEAKTFVEQTGVDALAISIGTAHGFYKQEP
KLQFDLLSEIAAATEATLVLHGSSGVPEEQLRKAISGGICKVNLATEIKNIFMKTLQQLL
LQNEEIDLRKVFPKATKEVTDLVSYKLDIMKNDK