Protein Info for Echvi_0149 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Protein of unknown function (DUF3667).

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 46 to 59 (14 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 227 to 246 (20 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 286 to 305 (20 residues), see Phobius details amino acids 317 to 340 (24 residues), see Phobius details PF12412: DUF3667" amino acids 53 to 97 (45 residues), 59.7 bits, see alignment 8e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUL2 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Echvi_0149 Protein of unknown function (DUF3667). (Echinicola vietnamensis KMM 6221, DSM 17526)
MKEARKNDFCLNCNHSLCEEDNFCPNCGQENKDQKVPFWVFISDFFANYLNFESLFFRTV
PAFLLKPGKLTIAFNEGKRRKYLHPIRLYLILSLFYFFAIGIIIPPDIFDRIMVNEFSDV
VTSELIDSNLETSLSEQDRQELDSLIKQHQIDSIKNRFYQQNQSQNDTTTNWMELKMAAQ
DPQISDSTFYGILNATDYVLFDEVDTAIQRNFIANSNLFIISSAQNLPIMMFVLLPFFAL
LLKLLYFRRGTYYVEHLIEGLHMHSFAYLIYGCGIFLFNLNMANSSMIIITCFVLVSTYA
YISMMRIHRQHWLRTLLKFWVLGFVYFSTLFIAIGIELYVSLRLM