Protein Info for Echvi_0144 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: TIGR00159 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 57 (20 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details PF19293: CdaA_N" amino acids 9 to 87 (79 residues), 60.2 bits, see alignment E=1.9e-20 TIGR00159: TIGR00159 family protein" amino acids 14 to 259 (246 residues), 207.1 bits, see alignment E=1.4e-65 PF02457: DAC" amino acids 127 to 243 (117 residues), 134.2 bits, see alignment E=1.7e-43

Best Hits

KEGG orthology group: None (inferred from 69% identity to mtt:Ftrac_3720)

Predicted SEED Role

"Diadenylate cyclase spyDAC; Bacterial checkpoint controller DisA with nucleotide-binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUK7 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Echvi_0144 TIGR00159 family protein (Echinicola vietnamensis KMM 6221, DSM 17526)
MNLLFKIGFLDISIVNIIDITLVSILIYQVYKLMRGSVAIKIFLGFLSIYLVYLVVNAAR
MELLSSILGQFMGVGVIAAIILFAPEIRKFLLIIGRSSILSNENVLQELLFWRKKETNAF
NITPIIDACKSLSGTSTGALMVVSRNTELKFYAESGDLIDAIVSKRLLISIFNKYSPLHD
GAVILYNGKVKAARCILPVTEKEVPAKFGLRHRAAIGMSEATDTLVLIVSEETGQVSMAK
NGNILHNLSFQEVREMLNNYLTGVDIDDKFEMISPFESKKLKQRTAEA