Protein Info for Echvi_0137 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: prolyl-tRNA synthetase, family I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 TIGR00408: proline--tRNA ligase" amino acids 7 to 493 (487 residues), 548.9 bits, see alignment E=5.7e-169 PF00587: tRNA-synt_2b" amino acids 113 to 282 (170 residues), 76.8 bits, see alignment E=3.5e-25 PF03129: HGTP_anticodon" amino acids 301 to 391 (91 residues), 60.3 bits, see alignment E=2.5e-20 PF09180: ProRS-C_1" amino acids 426 to 493 (68 residues), 86 bits, see alignment E=2.3e-28

Best Hits

Swiss-Prot: 74% identical to SYP_GRAFK: Proline--tRNA ligase (proS) from Gramella forsetii (strain KT0803)

KEGG orthology group: K01881, prolyl-tRNA synthetase [EC: 6.1.1.15] (inferred from 77% identity to dfe:Dfer_0217)

Predicted SEED Role

"Prolyl-tRNA synthetase (EC 6.1.1.15), archaeal/eukaryal type" (EC 6.1.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FR61 at UniProt or InterPro

Protein Sequence (493 amino acids)

>Echvi_0137 prolyl-tRNA synthetase, family I (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKGLPKRSEDYSQWYNELVKRADLAENSAVRGCMVIKPYGYSIWEKMQQQLDKMFKDTG
HSNAYFPLFIPKSYLSKEASHVEGFAKECAVVTHYRLKNDEEGKGVIVDPEAKLEEELIV
RPTSETVIWSTYRNWIQSYRDLPLKVNQWANVVRWEMRTRLFLRTAEFLWQEGHTAHATR
EEAVEETELMMNVYAQFAEEHMGVPVVKGIKTASERFAGAEETYCIEALMQDGKALQAGT
SHFLGQNFANAFDVKFATKEGGLEHVWGTSWGVSTRLMGALIMAHSDDNGLVLPPKLAPI
QVVIVPIFRSEEELQAVEEKAHDIMDKLKPLGISVHFDHRDTHKPGWKFAEYELKGVPLR
IAMGPRDLANNTIEIARRDTLTKEMVNLGEVEIGEYITDKLEEIQSTIYQKALQFRQENT
TAVDSWNEFQEVLESKGGFIAAHWDGTPETEEKIKELTKATIRCIPLDQVKEEGKCVLTG
NPSSGRVLFAKAY