Protein Info for Echvi_0132 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR01035: glutamyl-tRNA reductase" amino acids 7 to 416 (410 residues), 323.3 bits, see alignment E=1.2e-100 PF05201: GlutR_N" amino acids 8 to 158 (151 residues), 138.5 bits, see alignment E=4e-44 PF01488: Shikimate_DH" amino acids 174 to 303 (130 residues), 102 bits, see alignment E=7.4e-33 PF03446: NAD_binding_2" amino acids 187 to 256 (70 residues), 21.6 bits, see alignment E=5.1e-08 PF00745: GlutR_dimer" amino acids 319 to 415 (97 residues), 84.5 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 56% identical to HEM1_CYTH3: Glutamyl-tRNA reductase (hemA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 62% identity to mtt:Ftrac_2957)

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.70

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FR56 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Echvi_0132 glutamyl-tRNA reductase (Echinicola vietnamensis KMM 6221, DSM 17526)
MQHNFSAISLSYKNAPVEIREIIALDDKAIHSLLIKLKEFFNVKDTLILSTCNRTEVYYA
HELDLSTEIIKLIGTEKGLHNVVSYLEYFTIIQDDKKAIEHLFKVSMGLEAQVVGDMQIS
NQVKRAYQASADMEMAGPFLHRLMHTIFFTNKRVVQETAFRDGAASVSYAAVELIEEITS
NTINPRILLVGLGEIGEDVAKNMVYVPNAKVTITNRTYEKALQMGTELGYNVIPFDKVHQ
AMQEADVVVSSISSSRPFITKELVKAFDIKSYKLFVDLSVPRSIETIVEDVPGVLLYNVD
NIQSKTTEALERRLAAVPQVEGIINESIDEFYNWKKEMMVSPTINKLKNALEQIRMEELE
RYMKNASEEEYAVIDKITKSMMQKIIKVPVVQLKAACKKDQAEEMIGIISDLFDLEKENT
KHS