Protein Info for Echvi_0122 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: 5-enolpyruvylshikimate-3-phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF00275: EPSP_synthase" amino acids 13 to 59 (47 residues), 28 bits, see alignment 4.9e-11 amino acids 64 to 395 (332 residues), 231.4 bits, see alignment E=8.5e-73

Best Hits

KEGG orthology group: K00800, 3-phosphoshikimate 1-carboxyvinyltransferase [EC: 2.5.1.19] (inferred from 56% identity to chu:CHU_0717)

Predicted SEED Role

"5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FR45 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Echvi_0122 5-enolpyruvylshikimate-3-phosphate synthase (Echinicola vietnamensis KMM 6221, DSM 17526)
MNNITLPVKNHFGEVTIPLPSSKSESNRVLIVDALTEGQNQISNLAEARDTQTMIRLLAE
DPETLDVLDAGTTMRFLTAYAALTNRRKTLTGTPRMCERPIGILVDALRAIGAKIEYKGK
EGYPPMETLGFEKQLTNKVQIRGDVSSQYISALLMNAPLLPEGLTLELTGKIGSKTYITM
TLELMKQFGIAYSFEGNTISIAPQSYKNTSFAVESDWSGASYWFSLLACADEGSFFLKGL
KENSLQGDSKIVEIMDKLGVQSEFKDDGILLTKKAITGLGSYDFTHCPDLAQTVAVTCAL
IGQKSQFTGLESLRIKETDRIYALQQELAKFNAKLEEGENGAFTVIPSTDIPANVTIETY
DDHRMGMAFMPLVTKTSVTLLDKEVVNKSYPSFWKHCVLAGIEAQ