Protein Info for Echvi_0114 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: N-acetylmuramoyl-L-alanine amidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01520: Amidase_3" amino acids 39 to 257 (219 residues), 192 bits, see alignment E=4.5e-61

Best Hits

KEGG orthology group: K01448, N-acetylmuramoyl-L-alanine amidase [EC: 3.5.1.28] (inferred from 63% identity to mtt:Ftrac_0087)

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUH4 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Echvi_0114 N-acetylmuramoyl-L-alanine amidase (Echinicola vietnamensis KMM 6221, DSM 17526)
MKRTSVKNVIIILFLTMAALLSAFVPAGERSPKFKMRRVVIDAGHGGKDPGTMGSRSKEK
DVALAIALKVGNYIQQYVPDVEVIYTRKTDVFIELKERANIANRNKADLFVSIHCNAVRG
SNAYGTETYVMGSNHFERNFDVVKRENSVMLQEDGYKENYDGFDPNSPESYMMVNLMQKA
YFANSLSLAQKVENDFKTRLNRHSRGVKQLPLYVLWTTSMPSVLIETGFLSNSNEERYLN
SENGQAYIASAIYRSIKAYKEEVEAF