Protein Info for Echvi_0109 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: FOG: WD40 repeat

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF00400: WD40" amino acids 8 to 44 (37 residues), 21.7 bits, see alignment 1.2e-07 amino acids 174 to 210 (37 residues), 37.3 bits, see alignment 1.4e-12 amino acids 221 to 251 (31 residues), 27.9 bits, see alignment (E = 1.3e-09) amino acids 268 to 299 (32 residues), 22.6 bits, see alignment 6.2e-08 PF13570: PQQ_3" amino acids 91 to 127 (37 residues), 21.4 bits, see alignment 1.4e-07 PF02239: Cytochrom_D1" amino acids 159 to 295 (137 residues), 25.7 bits, see alignment E=2.1e-09

Best Hits

KEGG orthology group: None (inferred from 52% identity to chu:CHU_0759)

Predicted SEED Role

"High-affnity carbon uptake protein Hat/HatR" in subsystem CO2 uptake, carboxysome or Carboxysome

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUG8 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Echvi_0109 FOG: WD40 repeat (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKIQVNKLYTLTGHNDSIFALVEGNDPRFFYTGAGDGMVVQWDLANPKDGKLIAKLPNS
VYALEVDSLRGLLYIGHNFEGIHVIDLDTNKEIWSLKITDAAIFDIKAYEGRLYVGTGDG
VITVLDIEERSLLKHIKLGEESIRVLDVDSERGHLAVGASDNTVKVLDLETYAPISRMEG
HTNSVFALRYSPDRKLLVSGGRDAHLKIWDTGDYRQVEDIVAHMYAINYLAFREDGKYFV
TCSMDKSIKLWETETFQLRKVIDKSRHAGHGTSVNKVIWSRYSQQVVAVSDDRTVSIWDI
ALDEKI