Protein Info for Echvi_0089 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: methylmalonyl-CoA epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 PF00903: Glyoxalase" amino acids 3 to 128 (126 residues), 64.7 bits, see alignment E=1.6e-21 TIGR03081: methylmalonyl-CoA epimerase" amino acids 3 to 130 (128 residues), 139.2 bits, see alignment E=5.6e-45 PF13468: Glyoxalase_3" amino acids 5 to 130 (126 residues), 32 bits, see alignment E=1.9e-11 PF13669: Glyoxalase_4" amino acids 6 to 115 (110 residues), 82 bits, see alignment E=5.5e-27

Best Hits

Swiss-Prot: 43% identical to MCE_PYRHO: Methylmalonyl-CoA epimerase (PH0272) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K05606, methylmalonyl-CoA epimerase [EC: 5.1.99.1] (inferred from 70% identity to cly:Celly_1290)

MetaCyc: 33% identical to methylmalonyl-CoA epimerase monomer (Metallosphaera sedula)
Methylmalonyl-CoA epimerase. [EC: 5.1.99.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FUE8 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Echvi_0089 methylmalonyl-CoA epimerase (Echinicola vietnamensis KMM 6221, DSM 17526)
MRKIEHLGIAVKDLKKSNELFSRLFGKEAYKEERVEDEGVLTSFFQVGDVKIELLEATAP
DSPIAKFIDKRAEGVHHVAFAVDDIYAEMDRLKKAGFEILNDVPKKGADHKLVVFLHPRS
TNGVLVELCQDDVK