Protein Info for Echvi_0088 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: thiamine-monophosphate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01379: thiamine-phosphate kinase
  • amino acids 12 to 342 (331 residues), 330.6 bits, E=4.2e-103
• PF00586: AIRS
  • amino acids 36 to 149 (114 residues), 97.3 bits, E=7.4e-32
• PF02769: AIRS_C
  • amino acids 212 to 324 (113 residues), 26.7 bits, E=5.8e-10

Best Hits

KEGG orthology group: K00946, thiamine-monophosphate kinase [EC: 2.7.4.16] (inferred from 65% identity to mtt:Ftrac_1576)

Predicted SEED Role

"Thiamine-monophosphate kinase (EC 2.7.4.16)" in subsystem Thiamin biosynthesis (EC 2.7.4.16)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• thiamine diphosphate salvage II (5/5 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• thiamine diphosphate salvage V (3/3 steps found)
• thiamine diphosphate biosynthesis I (E. coli) (2/2 steps found)
• thiamine diphosphate biosynthesis II (Bacillus) (2/2 steps found)
• thiamine diphosphate salvage I (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.16

Sequence Analysis Tools

See L0FUM9 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Echvi_0088 thiamine-monophosphate kinase (Echinicola vietnamensis KMM 6221, DSM 17526)
MSDKRTEIGEIGEFGLIDRLHEKIKVRHADTLKGIGDDAAVLDAGDKVKVVTTDLLLEGV
HFDLSYAPLHHLGFKAVAVNISDIAAMNAIPKQITVSIALSNRFAVEAVEALYAGINAAA
EHYNIDVVGGDTTSSRSGLVISITAIGEVEKGKEVYRSGAKENDIVCVTGDLGGALMGLQ
VLEREKEVFMANPNMQPQLEKYTLVTGRQLKPDARMDIIHELRELGVVPTAMLDVSDGLA
SELFHICKQSKVGVTIYEDKLPIDKQTYDTAVEFNIDPITCVLNGGEDYELVFTIDQNDF
SKLEKHPDVHFIGHITKAESGKFMVTKSETAVELKAQGWVHFPEGGKSS