Protein Info for Echvi_0087 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: crossover junction endodeoxyribonuclease RuvC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 61% identical to RUVC_CYTH3: Crossover junction endodeoxyribonuclease RuvC (ruvC) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K01159, crossover junction endodeoxyribonuclease RuvC [EC: 3.1.22.4] (inferred from 70% identity to mtt:Ftrac_3235)

Predicted SEED Role

"Crossover junction endodeoxyribonuclease RuvC (EC 3.1.22.4)" in subsystem DNA-replication or RuvABC plus a hypothetical (EC 3.1.22.4)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.22.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FR06 at UniProt or InterPro

Protein Sequence (189 amino acids)

>Echvi_0087 crossover junction endodeoxyribonuclease RuvC (Echinicola vietnamensis KMM 6221, DSM 17526)
MSKIAKKDVKEQIILGIDPGTNVMGYGLVLVKGNKYEPLQFGVIHLKKYGSHELKLKKIF
ERVTGIIDEFLPDKVALEAPFYGQNVQSMLKLGRAQGVAMAAALARDIPIAEYSPKKVKQ
SVTGNGNASKEQVAEMLKTLLHIDVPKLLDATDALAVALCHHFHDGRLQTRGRTAGWKAF
LDENPGRIK