Protein Info for Echvi_0082 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Glycosyltransferases, probably involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 275 to 299 (25 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details PF13506: Glyco_transf_21" amino acids 24 to 367 (344 residues), 84.7 bits, see alignment E=1.5e-27 PF13704: Glyco_tranf_2_4" amino acids 42 to 97 (56 residues), 31 bits, see alignment 5.5e-11 PF13641: Glyco_tranf_2_3" amino acids 42 to 272 (231 residues), 75.8 bits, see alignment E=1.1e-24 PF00535: Glycos_transf_2" amino acids 45 to 214 (170 residues), 81.9 bits, see alignment E=1.4e-26 PF13632: Glyco_trans_2_3" amino acids 133 to 355 (223 residues), 67.1 bits, see alignment E=4.7e-22

Best Hits

KEGG orthology group: None (inferred from 39% identity to mtt:Ftrac_0621)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FR00 at UniProt or InterPro

Protein Sequence (367 amino acids)

>Echvi_0082 Glycosyltransferases, probably involved in cell wall biogenesis (Echinicola vietnamensis KMM 6221, DSM 17526)
MMLWVALAVVVILIAQDILLVYFFHARFKRHDEGLQWKEQLPTVSVIIPARNEIQVLPTC
LAALSRLDYPSEKLQLLVADDQSIDGTGPMLEAWASEGANREKVKIEAKYTHLNGKANAL
AQMAQKASGELLLFTDADCEVNPMWVKAMVKAYTPKVGLVVGLTSVRRRGLFGRLQGQDW
WLTLGMIKVTSDVGHLLTAVGNNMLISQEAYRRVGGFEGLPFSVTEDFVMGEAIKAAGFR
PIFQFDQESLVLTKSETGLHALLRQRKRWMRGALNLPWFWQAVLALQVLFFPMVVIILFS
TPLLGLGLWGCKLMFQVMFVRGLAKKANIYIPLWELFIFEVYYLVISWSTIVYYFWPSKV
NWKERTY