Protein Info for Echvi_0026 in Echinicola vietnamensis KMM 6221, DSM 17526

Annotation: Site-specific recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 transmembrane" amino acids 178 to 193 (16 residues), see Phobius details PF02899: Phage_int_SAM_1" amino acids 125 to 197 (73 residues), 25.4 bits, see alignment E=1.4e-09 PF00589: Phage_integrase" amino acids 224 to 393 (170 residues), 92.3 bits, see alignment E=3e-30

Best Hits

KEGG orthology group: None (inferred from 59% identity to gfo:GFO_1353)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0FQU3 at UniProt or InterPro

Protein Sequence (422 amino acids)

>Echvi_0026 Site-specific recombinase XerD (Echinicola vietnamensis KMM 6221, DSM 17526)
MNKHFTEFNELTNSAGNYLEQKLCYSLKTSYEYAKVWKRLREFMFSNGFSHYDKSVEEQF
LRFNFKNKSWKDLTVSQRVTYNGLKMLTEYHQTGKINIPSLPSKYPLDFRGPIGKVILDF
LRRRQQRGMSRSSLHNYQRHLYEFMEYCEKRGIGSVGYIDLPLLLHFINQYNCDKKTVMI
VLISTLRIFLRYLFKENLTAIDYSSKVPRCKKVTQPKIPSLYSKEEVEKLIASVDRSSPT
GKRNYAIIMLAARLGLRASDISRLKFKNLHWNTSTIEIDQVKTGNPLQLPLLPDVGNAII
DYLQYGRPVSEEPHVFLTGRPPYGCFTTSNVVTHVVQRAIIKAGIDTKNRRFGPHSLRHS
LGFRMLEKSTMLPVISEVFGHKSSESTRFYLRIDLTSMKQCMLDVPPVPTEFYQQRGGAF
YG