Protein Info for EX28DRAFT_4497 in Enterobacter asburiae PDN3

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 307 to 325 (19 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details PF02646: RmuC" amino acids 136 to 433 (298 residues), 368.1 bits, see alignment E=1.4e-114

Best Hits

Swiss-Prot: 89% identical to RMUC_SHIFL: DNA recombination protein RmuC (rmuC) from Shigella flexneri

KEGG orthology group: K09760, DNA recombination protein RmuC (inferred from 96% identity to enc:ECL_04963)

Predicted SEED Role

"DNA recombination protein RmuC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>EX28DRAFT_4497 Uncharacterized protein conserved in bacteria (Enterobacter asburiae PDN3)
MDISILIYAVIALVGLGIGWLISSYQHAQQKADQLAEREEMVADLSATKQQLALSEHWRD
ECELLNNELRNLRDINTSLEADLREVTTRLESTQLHAEDKIRQMINSEQRLSEQFENLAN
RIFEHSNRRVDEQNRQSLNSLLTPLREQLDGFRRQVQDSFGQEARERHTLAHEIRNLQQL
NAQMAQEAVNLTRALKGDNKTQGNWGEVVLTRVLEASGLREGYEYETQVSIENDARSRMQ
PDVIVRLPQGKDVVIDAKMTLVAYERYFNADDDYTRESALQEHIASVRNHIRLLGRKDYQ
QLPGLRSLDYVLMFIPVEPAFLLALDRQPELITEALKNNIMLVSPTTLLVALRTIANLWR
YEHQSRNAQQIADRASKLYDKMRLFVDDMSSVGQSLDRAQDNYRQAMKKLASGRGNLLAQ
AESFRSLGVEVKREINPELVEQATAQDDEFRLREGADEQNTNSEDNTLAADLSPDETPAR
FFRGG