Protein Info for EX28DRAFT_4489 in Enterobacter asburiae PDN3

Annotation: The Resistance to Homoserine/Threonine (RhtB) Family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 39 to 65 (27 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details PF01810: LysE" amino acids 14 to 202 (189 residues), 177.2 bits, see alignment E=1.4e-56 TIGR00949: homoserine/Threonine efflux protein" amino acids 19 to 200 (182 residues), 190.1 bits, see alignment E=1.5e-60

Best Hits

Swiss-Prot: 89% identical to RHTB_SALTI: Homoserine/homoserine lactone efflux protein (rhtB) from Salmonella typhi

KEGG orthology group: K05834, homoserine/homoserine lactone efflux protein (inferred from 97% identity to enc:ECL_04971)

MetaCyc: 89% identical to L-homoserine/L-homoserine lactone/L-threonine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-242; TRANS-RXN-242A; TRANS-RXN0-0244

Predicted SEED Role

"Homoserine/homoserine lactone efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (206 amino acids)

>EX28DRAFT_4489 The Resistance to Homoserine/Threonine (RhtB) Family protein (Enterobacter asburiae PDN3)
MTFEWWFAYLLTSIILSLSPGSGAINTMTTSINHGYRGAAASIAGLQTGLGIHIVLVGIG
LGTLFSRSVLAFEVLKWAGAAYLIWLGIQQWRAAGSINLNTLAQTQNRGHLFKRAVFVNL
TNPKSIVFLAALFPQFIVPHQPQVMQYVVLGATTIIVDIIVMIGYATLAQRIAAWIKGPK
QMKALNKVFGSLFMLVGALLASARHA