Protein Info for EX28DRAFT_4461 in Enterobacter asburiae PDN3

Annotation: 4-alpha-L-fucosyltransferase glycosyl transferase group 56

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF07429: Glyco_transf_56" amino acids 1 to 355 (355 residues), 601 bits, see alignment E=4e-185

Best Hits

Swiss-Prot: 81% identical to WECF_CITK8: TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase (wecF) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K12582, TDP-Fuc4NAc transferase [EC: 2.4.1.-] (inferred from 92% identity to enc:ECL_04994)

MetaCyc: 77% identical to TDP-N-acetylfucosamine:lipid II N-acetylfucosaminyltransferase (Escherichia coli K-12 substr. MG1655)
FUC4NACTRANS-RXN [EC: 2.4.1.325]

Predicted SEED Role

"4-alpha-L-fucosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.325

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>EX28DRAFT_4461 4-alpha-L-fucosyltransferase glycosyl transferase group 56 (Enterobacter asburiae PDN3)
MTALIHILGSDIPHHNQTVLRFFNDELASGNPDAREFMVAGQDKGLSEAFPALTIRFWPD
KAALAKAVVAKAKADRKQRFFFHGQFNTGLWLALLSGGITPSQCSWHIWGADLYEVSRGW
KFRLFYPLRRMAQGRVGCVFATRGDLNYFAKQHPNVRGELLYFPTRMDPALNAMANDAVR
EGKLTILVGNSGDRSNEHVAALRAVHQQFGDTVNVVVPMGYPTNNDAYIADVRQQGLALF
SAENLHILSDKLEFDEYLALLRKCDLGYFIFARQQGIGTLCLLIQAGVPCVLNRDNPFWQ
DMAEQHIPVLFTSDTLNVEVVREAQRQLTLVDKNSIDFFSPNYLTPWHRALRIASGDKA