Protein Info for EX28DRAFT_4458 in Enterobacter asburiae PDN3

Annotation: TDP-D-fucosamine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR02382: TDP-D-fucosamine acetyltransferase" amino acids 45 to 225 (181 residues), 279.3 bits, see alignment E=6.8e-88 PF00583: Acetyltransf_1" amino acids 115 to 209 (95 residues), 31.2 bits, see alignment E=1.2e-11

Best Hits

Swiss-Prot: 66% identical to WECD_ECOL6: dTDP-fucosamine acetyltransferase (wecD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 87% identity to enc:ECL_04997)

MetaCyc: 66% identical to RffC (Escherichia coli K-12 substr. MG1655)
TDPFUCACTRANS-RXN [EC: 2.3.1.210]

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein RffC"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.210

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>EX28DRAFT_4458 TDP-D-fucosamine acetyltransferase (Enterobacter asburiae PDN3)
MNSLNGVLESLQWESAFFGLPSAIVRLRDDAPVLAESDFIAWQRVQAKIPAERADLLDAL
QQYGFQLVEGEVDLSITLIRHDASGAEVANEQDIPVLRQMAAQAFAQSRFRAPWYAPDDS
GRFYAQWIENAVKGTFDHVCLVFRAGDGQIQGFVSLRKLNEREARIGLLAGRGMGEKLMQ
AALHWAQQQQLVTLRVATQLGNTAALKRYIASGANIDATAYWLYR