Protein Info for EX28DRAFT_4455 in Enterobacter asburiae PDN3

Annotation: Chain length determinant protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02706: Wzz
  • amino acids 15 to 81 (67 residues), 53.2 bits, E=1.5e-18

Best Hits

Swiss-Prot: 86% identical to WZZE_SALTY: ECA polysaccharide chain length modulation protein (wzzE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05790, lipopolysaccharide biosynthesis protein WzzE (inferred from 94% identity to enc:ECL_05000)

MetaCyc: 85% identical to enterobacterial common antigen polysaccharide co-polymerase (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"regulator of length of O-antigen component of lipopolysaccharide chains" in subsystem KDO2-Lipid A biosynthesis

Protein Sequence (348 amino acids)

>EX28DRAFT_4455 Chain length determinant protein (Enterobacter asburiae PDN3)
MTQPLAGAKSVVTENELDIRGLFRVLWAGKLWIAGIALGFALLALAYTFFAKQEWSATAI
TDKPTVNMLGGYYSQQQFLRNLDIKASLATPDQASVMDEAYKEFVMQLASWDTRRDFWSQ
TDYYKQRRVDNTKADAALLDDLINNIQFMPGDALRSVNDSVKLIAETAPDANNLLRQYVA
FASQRAASHLNEELKGAWAARTIQMKAQVKRQEEVANTIFGRRVHNIEQALKIAEQHNIS
RTETDVPADELPDSEMFLLGRPMLQARLENLKAVGPDFDLDYDQNRAMLNTLNVGPSLDP
RFQTYRYLRTPEEPVKRDSPRRAFLMIMWGIVGALTGAGVALARRRKN