Protein Info for EX28DRAFT_4444 in Enterobacter asburiae PDN3

Annotation: threonine ammonia-lyase, biosynthetic, long form

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 TIGR01124: threonine ammonia-lyase, biosynthetic" amino acids 16 to 513 (498 residues), 882.8 bits, see alignment E=3.1e-270 PF00291: PALP" amino acids 29 to 317 (289 residues), 269.4 bits, see alignment E=4.1e-84 PF00585: Thr_dehydrat_C" amino acids 330 to 420 (91 residues), 92.2 bits, see alignment E=1.5e-30 amino acids 426 to 513 (88 residues), 99.8 bits, see alignment E=6.4e-33

Best Hits

Swiss-Prot: 95% identical to ILVA_SALTY: L-Threonine dehydratase biosynthetic IlvA (ilvA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01754, threonine dehydratase [EC: 4.3.1.19] (inferred from 95% identity to eoj:ECO26_4814)

MetaCyc: 95% identical to threonine deaminase (Escherichia coli K-12 substr. MG1655)
Threonine ammonia-lyase. [EC: 4.3.1.19]

Predicted SEED Role

"Threonine dehydratase biosynthetic (EC 4.3.1.19)" in subsystem Branched-Chain Amino Acid Biosynthesis (EC 4.3.1.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.19

Use Curated BLAST to search for 4.3.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (515 amino acids)

>EX28DRAFT_4444 threonine ammonia-lyase, biosynthetic, long form (Enterobacter asburiae PDN3)
MMAESQPLSAAPEGAEYLRAVLRAPVYEAVQVTPLQKMEKLSSRLDNVILVKREDRQPVH
SFKLRGAYAMMAGLTDEQKARGVITASAGNHAQGVAFSSARLGLKALIVMPVATADIKVD
AVRGFGGEVLLHGANFDEAKAKAIELAQQQGFTWVPPFDHPMVIAGQGTLALELLQQDAH
LDRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAEDSACLKAALDAGHPVDLPRVGLFA
EGVAVKRIGDETFRLCQEYLDDIVTVDSDAICAAMKDLFEDVRAVAEPSGALALAGMKKY
VAQHNIRGERLAHVLSGANVNFHGLRYVSERCELGEQREALLAVTIPEEKGSFLKFCQLL
GGRSVTEFNYRFADAKDACIFVGVRLSHGVEERKEILNLLHEGGYSVVDLSDDEMAKLHV
RYMVGGRPSKPLRERLFSFEFPESPGALLKFLHTLGTHWNISLFHYRSHGTDYGRVLAAF
ELGEHEPDFETRLNELGYECHDETHNPAFRFFLAG