Protein Info for EX28DRAFT_4396 in Enterobacter asburiae PDN3

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 63 (17 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details PF05656: DUF805" amino acids 7 to 131 (125 residues), 68 bits, see alignment E=5.1e-23

Best Hits

Swiss-Prot: 73% identical to YIIR_ECOLI: Uncharacterized protein YiiR (yiiR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to enc:ECL_05054)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>EX28DRAFT_4396 Predicted membrane protein (Enterobacter asburiae PDN3)
MTIQQWLFSFKGRIGRRDFWIWMVTWVVAMLLLFFVAYNAWLSTQTAAFALVCLLWPTAA
VVVKRLHDRGRSGAWAFLIILAWMLVAGNWAMLPSILPWVVGRLLPSVIFVMMIVDLGAF
IGTQSENKYGKDTVEVKYR