Protein Info for EX28DRAFT_4367 in Enterobacter asburiae PDN3

Annotation: haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF00702: Hydrolase" amino acids 2 to 178 (177 residues), 51.2 bits, see alignment E=3.3e-17 PF13419: HAD_2" amino acids 66 to 184 (119 residues), 40.9 bits, see alignment E=3.4e-14 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 69 to 184 (116 residues), 62.7 bits, see alignment E=2.3e-21 PF13242: Hydrolase_like" amino acids 139 to 187 (49 residues), 22.5 bits, see alignment E=1.3e-08

Best Hits

Swiss-Prot: 83% identical to YIHX_SHIFL: Alpha-D-glucose-1-phosphate phosphatase YihX (yihX) from Shigella flexneri

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 96% identity to enc:ECL_05100)

MetaCyc: 83% identical to alpha-D-glucose-1-phosphate phosphatase YihX (Escherichia coli K-12 substr. MG1655)
Glucose-1-phosphatase. [EC: 3.1.3.10]

Predicted SEED Role

"Alpha-D-glucose-1-phosphatase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.10

Use Curated BLAST to search for 3.1.3.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>EX28DRAFT_4367 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED (Enterobacter asburiae PDN3)
MLYIFDLGNVIVDIDFNRVLGAWSDFSRVPLATLKHNFAMGETFHQHERGEISDEEFAER
FCQEMDLPLSYEQFSHGWQAVFVAIRPEAIDIMHKLREQGHRVVVLSNTNRLHTTFWPEE
YPEVKAAADKIYLSQEMGMRKPEARIYQAVLQSEGFTAADAVFFDDNADNIEGANQLGIT
SILVTGKETIPNYFAKQLC