Protein Info for EX28DRAFT_4355 in Enterobacter asburiae PDN3

Annotation: sugar (Glycoside-Pentoside-Hexuronide) transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 51 to 75 (25 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details amino acids 305 to 323 (19 residues), see Phobius details amino acids 329 to 352 (24 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details TIGR00792: sugar (Glycoside-Pentoside-Hexuronide) transporter" amino acids 17 to 452 (436 residues), 498.8 bits, see alignment E=5.8e-154 PF13347: MFS_2" amino acids 20 to 440 (421 residues), 280.2 bits, see alignment E=2.4e-87

Best Hits

Swiss-Prot: 85% identical to YIHO_SALTY: Putative sulfoquinovose importer (yihO) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03292, glycoside/pentoside/hexuronide:cation symporter, GPH family (inferred from 98% identity to enc:ECL_05108)

MetaCyc: 78% identical to putative sulfoquinovose transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-580

Predicted SEED Role

"Glucuronide transport protein YihO"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>EX28DRAFT_4355 sugar (Glycoside-Pentoside-Hexuronide) transporter (Enterobacter asburiae PDN3)
MTHNSDPLTLKLSLREKCAYGMGDFGSNLMLCIGTLYLLKFYTDELGMPAFYGGIIFLVA
KFFTALTDMLTGVLLDSRRNIGPRGKFRPFILYASVPVALVATAQFMANDFSLTVKTALA
TVLFMMFGLCYSLMNCAYGAMVPAITKNPNERAQLAAWRQGGATVGLLLCTVGFMPIQAL
FVSQPSLGYLVAALAFVTGGLFCMWWCYSGVKERYVELTPDHHKPGMLKSFCAIFRNPPL
LVLCIANLCTLAAFNIKLAIQVYYTQYVLNDLHLLSWMGFFSMGCILIGVFLVPGAVKRF
GKKPVYLGGLTLWAVGDVLNFFWGTSSLLFVLFSCMAFFGTAFVNSLNWALVPDTVDYGE
WKTGIRAEGSVYTGYTFSRKISAALAGFLPGIMLTQIGYVPHAAQSAGTLLGLRQLIFLW
PCGLAIVAAVTMGLFYKLNEARFAFIIEEIGKRKKQSANTPEITTNNKASAVTL