Protein Info for EX28DRAFT_4309 in Enterobacter asburiae PDN3

Annotation: Maltose-binding periplasmic proteins/domains

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01547: SBP_bac_1" amino acids 46 to 312 (267 residues), 151.8 bits, see alignment E=4.6e-48 PF13416: SBP_bac_8" amino acids 50 to 344 (295 residues), 130.6 bits, see alignment E=1e-41

Best Hits

Swiss-Prot: 94% identical to MALE_SALTY: Maltose/maltodextrin-binding periplasmic protein (malE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10108, maltose/maltodextrin transport system substrate-binding protein (inferred from 99% identity to enc:ECL_00290)

MetaCyc: 93% identical to maltose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-16-RXN [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, substrate binding periplasmic protein MalE" in subsystem Bacterial Chemotaxis or Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>EX28DRAFT_4309 Maltose-binding periplasmic proteins/domains (Enterobacter asburiae PDN3)
MNIKTGARVFALSALAAMMVSAPALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK
VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEVTPDKAFQDKLFPFTW
DAVRYNGKLIAYPIAVEALSLIYNKDLVPNPPKTWEEIPKLDKELKAKGKSALMFNLQEP
YFTWPLIAADGGYAFKFENGKYDVKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAE
AAFNKGETAMTINGPWAWTNIDKSKVNYGVTLLPTFKGKPSKPFVGVLSAGINAASPNKE
LAKEFLENYLLTDQGLDEVNKDKPLGAVALKSFQDQLAKDPRIAATMDNAQKGEIMPNIP
QMAAFWYATRTAVINAASGRQTVDAALKDAQGRITK