Protein Info for EX28DRAFT_4301 in Enterobacter asburiae PDN3

Annotation: Protein of unknown function (DUF2500)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details PF10694: DUF2500" amino acids 5 to 115 (111 residues), 108.4 bits, see alignment E=1.4e-35

Best Hits

Swiss-Prot: 77% identical to YHHM_ECOLI: Uncharacterized protein YhhM (yhhM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_04829)

Predicted SEED Role

"Putative receptor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (118 amino acids)

>EX28DRAFT_4301 Protein of unknown function (DUF2500) (Enterobacter asburiae PDN3)
MSKMPLFFIIVVAIIVIAASFRFVQQRREKADNDVAPLMQKRVEVTNKREKPLNDRRSRQ
QQVTPAGTAMRYEASFKPETGGLEMTFRLEAQQYHQLTVGDKGTLSYKGSRFEGFRTE