Protein Info for EX28DRAFT_4263 in Enterobacter asburiae PDN3

Annotation: tRNA dihydrouridine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR00742: tRNA dihydrouridine synthase A" amino acids 13 to 328 (316 residues), 573.4 bits, see alignment E=7.3e-177 PF01207: Dus" amino acids 16 to 326 (311 residues), 346.4 bits, see alignment E=6.9e-108

Best Hits

Swiss-Prot: 94% identical to DUSA_ECOL6: tRNA-dihydrouridine(20/20a) synthase (dusA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 98% identity to enc:ECL_00307)

MetaCyc: 95% identical to tRNA-dihydrouridine synthase A (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase A (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>EX28DRAFT_4263 tRNA dihydrouridine synthase A (Enterobacter asburiae PDN3)
MSSELQTAFPAHRFSIAPMLDWTDRHCRYFLRQLSRHTLLYTEMVTTGAIIHGKGDYLAY
SEEEHPVALQLGGSDPAALAQCAKLAEERGYDEINLNVGCPSDRVQNGMFGACLMGNAQL
VADCIKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFINTVSGKGECEMFIIHARKAWLSG
LSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSLEEAKAHLAHMDGVMVGREAYQN
PGILATVDREIFGVEGADTDPVAVVRAMYPYIERELSNGTYLGHITRHMLGLFQGIPGAR
QWRRYLSENAHKAGADIEVLEHALRLVADKR