Protein Info for EX28DRAFT_4220 in Enterobacter asburiae PDN3

Annotation: ketose-bisphosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00167: ketose-bisphosphate aldolase" amino acids 4 to 286 (283 residues), 269.3 bits, see alignment E=2e-84 PF01116: F_bP_aldolase" amino acids 6 to 285 (280 residues), 313.1 bits, see alignment E=9.5e-98

Best Hits

Swiss-Prot: 42% identical to ALF_BACSU: Probable fructose-bisphosphate aldolase (fbaA) from Bacillus subtilis (strain 168)

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 97% identity to enc:ECL_00340)

MetaCyc: 40% identical to tagatose-1,6-bisphosphate aldolase 1 (Escherichia coli K-12 substr. MG1655)
Tagatose-bisphosphate aldolase. [EC: 4.1.2.40]

Predicted SEED Role

"Putative aldolase Z5687"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13, 4.1.2.40

Use Curated BLAST to search for 4.1.2.13 or 4.1.2.40

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>EX28DRAFT_4220 ketose-bisphosphate aldolase (Enterobacter asburiae PDN3)
MPLISLADGLEHARAHRYALGAFNVLDSHFLRALFAAAKQERSPFIINIAEVHFKYVSLD
SLVEAVKFEAARHDIPVVLNLDHGLHFEAVVRALRLGFSSVMFDGSTLSYEENIRQTREV
VKMCHAVGVSVEAELGAVGGDEGGALYGHADEAFFTDPQLAREFVDSTGIDALAVAIGNA
HGKYKGEPKLDFPRLDAIRQQTGLPLVLHGGSGISDADFRRAIELGIHKINFYTGMSQAA
LAAVEQRMANRQPLYDEFAELLLGIEEAITDTVAEQMRIFGSAGQA