Protein Info for EX28DRAFT_4213 in Enterobacter asburiae PDN3

Annotation: phosphonate metabolism protein PhnP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details TIGR03307: phosphonate metabolism protein PhnP" amino acids 3 to 249 (247 residues), 399.1 bits, see alignment E=3.4e-124 PF12706: Lactamase_B_2" amino acids 73 to 223 (151 residues), 47.8 bits, see alignment E=6.6e-17

Best Hits

Swiss-Prot: 79% identical to PHNP_ECOLI: Phosphoribosyl 1,2-cyclic phosphate phosphodiesterase (phnP) from Escherichia coli (strain K12)

KEGG orthology group: K06167, PhnP protein (inferred from 96% identity to enc:ECL_00349)

MetaCyc: 79% identical to 5-phospho-alpha-D-ribosyl 1,2-cyclic phosphate phosphodiesterase (Escherichia coli K-12 substr. MG1655)
RXN0-6710 [EC: 3.1.4.55]

Predicted SEED Role

"Metal-dependent hydrolases of the beta-lactamase superfamily I; PhnP protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (252 amino acids)

>EX28DRAFT_4213 phosphonate metabolism protein PhnP (Enterobacter asburiae PDN3)
MSLTITLTGTGGAQLVPVFGCDCAACRRARLQDNYRRRPCSAVVKFNDAVTLLDAGIPHL
MDDWPAGSFQQFLLTHYHMDHVQGLFPLRWGVGTTIPVYGPPDEAGCDDLFKHPGILDFS
HTVEPFVMFELQGLRVTPLPLNHSKLTFGYLLESAHSRVAWLSDTAGLPEKTVKFLLNNQ
PQAIIIDCSHEPRDETPRNHCDLNTVIALNEVIGCPQVILTHISHQFDVWMMDNPLPQGI
EAGYDGMVLVLD