Protein Info for EX28DRAFT_4187 in Enterobacter asburiae PDN3

Annotation: sulfur relay protein TusB/DsrH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 TIGR03011: sulfur relay protein TusB/DsrH" amino acids 2 to 95 (94 residues), 106.1 bits, see alignment E=4.2e-35 PF04077: DsrH" amino acids 7 to 91 (85 residues), 99.7 bits, see alignment E=4.3e-33

Best Hits

Swiss-Prot: 74% identical to TUSB_ENT38: Protein TusB (tusB) from Enterobacter sp. (strain 638)

KEGG orthology group: K07237, tRNA 2-thiouridine synthesizing protein B (inferred from 97% identity to enc:ECL_04708)

MetaCyc: 63% identical to sulfurtransferase complex subunit TusB (Escherichia coli K-12 substr. MG1655)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusB"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (95 amino acids)

>EX28DRAFT_4187 sulfur relay protein TusB/DsrH (Enterobacter asburiae PDN3)
MLHTLSHSPWQCDINALLSMLREGDDLLLIQDGVLAALEGSRFVEILTNAPITVSALKDD
LDARGLSGQISAKIDVVGYTDFVNLTVTHASQMNW