Protein Info for EX28DRAFT_4176 in Enterobacter asburiae PDN3

Annotation: Predicted hydrolase of the alpha/beta-hydrolase fold

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 PF12146: Hydrolase_4" amino acids 72 to 288 (217 residues), 38.1 bits, see alignment E=1.1e-13 PF00561: Abhydrolase_1" amino acids 74 to 314 (241 residues), 109.4 bits, see alignment E=2.3e-35

Best Hits

Swiss-Prot: 79% identical to YHET_ECOLI: Putative esterase YheT (yheT) from Escherichia coli (strain K12)

KEGG orthology group: K07019, (no description) (inferred from 96% identity to enc:ECL_04729)

Predicted SEED Role

"Hydrolase, alpha/beta fold family functionally coupled to Phosphoribulokinase" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (340 amino acids)

>EX28DRAFT_4176 Predicted hydrolase of the alpha/beta-hydrolase fold (Enterobacter asburiae PDN3)
MTQIIPSDFDIAAEDSTEFVPMRGVANPHLQTMLPRLIRRKVQFTPHWQRLDLPDGDFLD
LAWSEAPEQARHKPRLVVFHGLEGSLHSPYAHGLIEAAKARGWLGVVMHFRGCSGEPNRQ
KRIYHSGETEDGTWFLHWLRDNFGTVPTAAVGYSLGGNMLACLLAKEGESVPLDAAVIVS
APFMLEQCSYHMEKGFSRVYQRYLLNLLKANAARKLKAYPDTLPVSLRQLKKVRRIREFD
DLITAKIHGFADAIDYYRQCSAMPLLSKITQPTLIIHAKDDPFMDHHSIPAQEFLPDNVH
YQLTEHGGHVGFIGGTLRRPKMWLEARIPDWLTPYLEGAK