Protein Info for EX28DRAFT_4151 in Enterobacter asburiae PDN3

Annotation: type IV pilus secretin (or competence protein) PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR02515: type IV pilus secretin PilQ" amino acids 2 to 383 (382 residues), 395.4 bits, see alignment E=1.7e-122 PF03958: Secretin_N" amino acids 98 to 154 (57 residues), 39.7 bits, see alignment E=4.5e-14 PF00263: Secretin" amino acids 224 to 383 (160 residues), 160 bits, see alignment E=4.2e-51

Best Hits

Swiss-Prot: 78% identical to HOFQ_ECOLI: DNA utilization protein HofQ (hofQ) from Escherichia coli (strain K12)

KEGG orthology group: K02507, protein transport protein HofQ (inferred from 82% identity to ent:Ent638_3804)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>EX28DRAFT_4151 type IV pilus secretin (or competence protein) PilQ (Enterobacter asburiae PDN3)
MVDDVPVVQVLQSLVAQENRNLVISPDVGGTLSLNLTRVPWRQALQTVVTSAGLVLREEG
GIFYVHTAAWQREQQERSEQERARRQLDAPLVSHGIAFSYADAGELQKDAEKLLSPKGSL
SLDKRTNRLLIRDNQTVVETLQRWAAQMDIPVEQVELAAHIVTINEKSLRELGVKWNLAD
AADAGKVGQLTTLGSDLSVASATSHVGFNIGRINGRLLDLELSALEQKQQVDIIASPRLL
ASHMQPASIKQGSEIPYQVSSGESGATSVEFKEAVLGMEVTPVVLPGGRVRLKLHISENM
PGQVLQQADGETLAIDKQEIETQVEVKSGETLALGGIFSQKNKTGSDSVPGLGKIPWLGQ
LFRHGGKDNERRELVVFITPRLVGIR