Protein Info for EX28DRAFT_4106 in Enterobacter asburiae PDN3

Annotation: Methylase involved in ubiquinone/menaquinone biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF21212: Dimerisation2-like_dom" amino acids 16 to 85 (70 residues), 46.1 bits, see alignment E=9.8e-16 PF00891: Methyltransf_2" amino acids 177 to 332 (156 residues), 60 bits, see alignment E=4.3e-20 PF08242: Methyltransf_12" amino acids 183 to 280 (98 residues), 30.8 bits, see alignment E=8.3e-11 PF13649: Methyltransf_25" amino acids 183 to 277 (95 residues), 34 bits, see alignment E=8.1e-12

Best Hits

KEGG orthology group: None (inferred from 89% identity to ent:Ent638_3883)

Predicted SEED Role

"Putative O-methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>EX28DRAFT_4106 Methylase involved in ubiquinone/menaquinone biosynthesis (Enterobacter asburiae PDN3)
MYEKDTLSALDAITEAQRIAFAPMLFQTALCLRNSGVLAWLDKQGKEGASLEEITEHSTL
GSYGVSVLLDMGLSGRIVTQQNGRYFLAKVGHFLLHDEMTRVNMDFTQDVCYQGLFHLAD
ALQEEKPAGLAVFGNWPTIYPALSQLPAAAKESWFAFDHYYSDAAFDAALPYIFASSPTK
LYDVGGNTGKWSLRCCRYDENVAVTILDLPQQIALAQENIAKAGFSHRIAFHAVDMLSPA
TLPGDADVWWMSQFLDCFSPDQIVAMLTRVAQAMKPGARLCIMELFWDAQKFEAASFSLN
ATSLYFTCMANGNSRFYSVEKFYRYLESAGFSVEQRLDNLGVGHTLLICTKREQ