Protein Info for EX28DRAFT_4074 in Enterobacter asburiae PDN3

Annotation: Sugar phosphate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 23 to 41 (19 residues), see Phobius details amino acids 60 to 79 (20 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 253 to 274 (22 residues), see Phobius details amino acids 289 to 307 (19 residues), see Phobius details amino acids 319 to 338 (20 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 375 to 400 (26 residues), see Phobius details amino acids 406 to 428 (23 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 392 (362 residues), 148 bits, see alignment E=1.7e-47

Best Hits

Swiss-Prot: 44% identical to TUB3_AGRVI: Putative tartrate transporter (ttuB) from Agrobacterium vitis

KEGG orthology group: None (inferred from 96% identity to enc:ECL_04869)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>EX28DRAFT_4074 Sugar phosphate permease (Enterobacter asburiae PDN3)
MTEHLRNGATATEDIERETMRKVIWRILPFLIVSYLVSIIDRGNIGMASLQMNEDLGLSK
AAFGFASSLYFVAYFLFEVPSNLAMQKVGARLWIPRIMISWGIVSMCMALVQNTTSLYIV
RFLLGAAEAGFFPGVVLYLTWWIPSRYRARIIASFMVAIPLANFIGSPLSGLILSLDGWL
GLRGWHLLFIIEGLPAVLLGIAAWFILRDRPHQAKWLSDEQKKWLETTLETERSQQKNIG
HQTTWQLLKHRQIWLMALIYAGASSAGTTISVWSPQLLKSFHLDNLETGLFNAIPYGLAS
VLMIVWGRNSDRTNERRWHTALTLFMIAAGVFAAFVSVSLSATLVILSIMLIGAYSMKGP
FWALASGWMSSTSAAAGLAAIGAIANLIGGAVMVNAYGIINERTGSYTLAMLPLAALCVA
GGIAVLIMGRQARRAQLHEKQVTH