Protein Info for EX28DRAFT_4064 in Enterobacter asburiae PDN3

Annotation: Putative SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF04445: SAM_MT" amino acids 33 to 260 (228 residues), 353.2 bits, see alignment E=2.8e-110

Best Hits

Swiss-Prot: 96% identical to RSMJ_ENT38: Ribosomal RNA small subunit methyltransferase J (rsmJ) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 94% identity to kpu:KP1_5202)

MetaCyc: 94% identical to 16S rRNA m2G1516 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-6731 [EC: 2.1.1.242]

Predicted SEED Role

"rRNA small subunit methyltransferase J"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.242

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>EX28DRAFT_4064 Putative SAM-dependent methyltransferase (Enterobacter asburiae PDN3)
MRCLSITGSKADCYVKICLVDETGAGDGALSVLAARWGLEHDEENLMALVMTPEHLELRK
RDEPKLGGIFVDFVGGAMAHRRKFGGGRGEAVAKAVGIKGSYLPDVVDATAGLGRDAFVL
ASVGCRVRMLERNPVVAALLDDGLARGYADPEVGPWLQERLQLIHASSLTALTDITPRPQ
VVYLDPMFPHKQKSALVKKEMRVFQSLVGPDLDADGLLEPARQLATKRVVVKRPDYAPPL
ADVATTNAVTTKGHRFDIYPGTPE