Protein Info for EX28DRAFT_4050 in Enterobacter asburiae PDN3

Annotation: Predicted Zn-dependent peptidases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 497 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF00675: Peptidase_M16" amino acids 50 to 157 (108 residues), 29.9 bits, see alignment E=4.7e-11 PF05193: Peptidase_M16_C" amino acids 200 to 377 (178 residues), 79.5 bits, see alignment E=2.9e-26

Best Hits

Swiss-Prot: 80% identical to YHJJ_ECOLI: Protein YhjJ (yhjJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_04931)

Predicted SEED Role

"Protein YhjJ, putative peptidase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (497 amino acids)

>EX28DRAFT_4050 Predicted Zn-dependent peptidases (Enterobacter asburiae PDN3)
MQGTKIRLLTGGLLMMAAASYVQADALQPDPAWQQGTLANGFQWQVLATPQRPSDRIEIR
LSINTGSLTESTQQTGFSHFIPRLALTQSGSLQAVQVRSLWQQAIDPKRPLPPAVVSYDY
TMFNLSLPNNRNDLLKEALTYLSDASGNLAITPDTVNYALSNSDMVATWPGDTKEGWWRY
RLKGSTLLGHDPAEPLKQPVDAEQVKSFYQKWYTPDAMTLIVVGNVDSRAVVEQINKAFG
DLKGKRETPAPVPTLSPLRAEPVSIMTDAVRQDRLSVMWDNAWQPIRESAAMLRYWRADL
AREALFWHVQQTLSKNNVKNIGLGFDCRVLFQRAQCAINVESPGDKLNANLGVVAKELAK
VRKEGLSEEEFNALVAQKKLELQKLFATYARADTDILISQRIRSLQNQVVDIAPEQYQKL
RQDFLNGLTVEMLNQDLRQQLSQEMALILLQPKGEPEYDMKELQTTWDSIMATAPQPAQA
ATADDLHPDATDIPQGQ