Protein Info for EX28DRAFT_4029 in Enterobacter asburiae PDN3

Annotation: transcriptional regulator, LacI family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF00356: LacI" amino acids 1 to 45 (45 residues), 75.3 bits, see alignment 4.9e-25 PF00532: Peripla_BP_1" amino acids 57 to 307 (251 residues), 114.8 bits, see alignment E=1.1e-36 PF13407: Peripla_BP_4" amino acids 59 to 301 (243 residues), 67.9 bits, see alignment E=2.2e-22 PF13377: Peripla_BP_3" amino acids 166 to 327 (162 residues), 142.7 bits, see alignment E=2.5e-45

Best Hits

Swiss-Prot: 89% identical to RBSR_ECOL6: Ribose operon repressor (rbsR) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 97% identity to enc:ECL_05128)

MetaCyc: 47% identical to DNA-binding transcriptional repressor PurR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ribose operon repressor" in subsystem D-ribose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>EX28DRAFT_4029 transcriptional regulator, LacI family (Enterobacter asburiae PDN3)
MKDVARMAGVSTSTVSHVINNDRFVSEAIREKVEAAVKELNYAPSALARSLKLNQTRTIG
MLITASTNPFYSELVRGVERSCFERGYSLVLCNTEGDEQRMNRNLETLMQKRVDGLLLLC
TETHQPSKEIIQRYPSIPTVMMDWAPFDGTSDLIQDNSLLGGDMATQHLIDKGHTRIACI
TGPLDKTPARLRLEGYLSAMERAGLAIPDGYRITGDFEFNGGFEAMQKLLAQKPRPQAVF
IGNDAMAFGAYQALYQAGLRVPDDMAVIGYDDIELASYMTPPLTTIHQPKDELGELAIDV
LIHRMAQPTLQQQRLQLTPVLMERGSV