Protein Info for EX28DRAFT_3944 in Enterobacter asburiae PDN3

Annotation: Arabinose efflux permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 89 to 107 (19 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 309 to 332 (24 residues), see Phobius details amino acids 344 to 365 (22 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 337 (310 residues), 124.8 bits, see alignment E=1.9e-40

Best Hits

Swiss-Prot: 86% identical to NEPI_SALTI: Purine ribonucleoside efflux pump NepI (nepI) from Salmonella typhi

KEGG orthology group: K03445, MFS transporter, DHA1 family, purine ribonucleoside efflux pump (inferred from 97% identity to enc:ECL_00044)

MetaCyc: 85% identical to purine ribonucleoside exporter (Escherichia coli K-12 substr. MG1655)
RXN0-18; RXN0-22

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>EX28DRAFT_3944 Arabinose efflux permease (Enterobacter asburiae PDN3)
MTEHIQPTTRPQTNEVSRPNWSAVFAVAFCVACLITVEFLPVSLLTPMAQDLGISEGVAG
QSVTVTAFVAMFASLFITQVIGTIDRRKVVILFSVLLTLSCLLVSFAESFTLLLLGRACL
GLGLGGFWAMSASLTMRLVPARTVPKALSVIFGAVSIALVIAAPLGSFLGGIIGWRNVFN
AAAVMGLVCIIWVWKALPSLPGEAAHHKQNMFALLKRPGVLAGMTAIFMSFAGQFAFFTY
IRPVFMTMAGFDVDGLTLVLLSFGIASFVGTSLSSQFLKRSLKVALAGAPLVLAASAAVL
VLWGSDKWVASAIAIIWGFAFALVPVGWSTWITRSLADQAEKAGSIQVAVIQLANTCGAA
IGGVALDHLGLTSPLVISGTLMLLTALLVAGKVKAK