Protein Info for EX28DRAFT_3852 in Enterobacter asburiae PDN3

Annotation: Protein of unknown function (DUF2810)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 PF10928: DUF2810" amino acids 66 to 116 (51 residues), 105.4 bits, see alignment E=6.5e-35

Best Hits

Swiss-Prot: 87% identical to YIBL_ECO57: Uncharacterized protein YibL (yibL) from Escherichia coli O157:H7

KEGG orthology group: K14762, ribosome-associated protein (inferred from 89% identity to ent:Ent638_0133)

Predicted SEED Role

"FIG00638433: Hypothetical protein YibL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (120 amino acids)

>EX28DRAFT_3852 Protein of unknown function (DUF2810) (Enterobacter asburiae PDN3)
MKEVEKNEIKRLSDRLDLIRHQMAGLSLVESAEKYAELEKEAATLETEIERLREVKGQKL
SKEAQKLMDMPHRRAITKKEQADMGKLKKSVRGLVVVHPMTELGREMGLKEMTGFCKTAF