Protein Info for EX28DRAFT_3699 in Enterobacter asburiae PDN3

Annotation: Type II secretory pathway, component PulF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 164 to 190 (27 residues), see Phobius details amino acids 211 to 233 (23 residues), see Phobius details amino acids 360 to 384 (25 residues), see Phobius details PF00482: T2SSF" amino acids 63 to 185 (123 residues), 107.7 bits, see alignment E=2.1e-35 amino acids 263 to 383 (121 residues), 84.1 bits, see alignment E=4e-28

Best Hits

KEGG orthology group: K02505, protein transport protein HofC (inferred from 79% identity to enc:ECL_00902)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (394 amino acids)

>EX28DRAFT_3699 Type II secretory pathway, component PulF (Enterobacter asburiae PDN3)
MAANQLWRWRALTKEGELRSGTLWATDRTAAFTRLMRSDLHPLALTRCAQRHRWRPHHCC
EMFRQLATLLQAGLTLSHSLQMLAEQHPLKPWQALLQSIADELSEGSPFSASLKKWPAVF
SPLHVSMVKTGELTGKLEECCRQLAQQQKAQQQLREKVKKSLRYPAIVLTLAVLVVLAMV
ILVLPEFAAIYKTFNTPLPMLTQMVMGMAAFMRSYALALFAALLAPFATAWALRQNPRWQ
RMLMHMPVMGALAKGQKLGHIFTVLSLTQQAGIPFLQGLESAEETVESCYWRGILCCVRE
DIEKGLPVWSSFQKAAIFTPLCIQLLRTGEMSGALDIMLANLARHHTEQTFQRADNLAAL
LEPVLLIVTGVIIGTLVVAMYLPIFHLGDAMSAG