Protein Info for EX28DRAFT_3619 in Enterobacter asburiae PDN3

Annotation: amino acid carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 476 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 179 to 197 (19 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 300 to 322 (23 residues), see Phobius details amino acids 347 to 370 (24 residues), see Phobius details amino acids 391 to 409 (19 residues), see Phobius details amino acids 415 to 438 (24 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 13 to 441 (429 residues), 511 bits, see alignment E=1.3e-157 PF01235: Na_Ala_symp" amino acids 50 to 452 (403 residues), 495.7 bits, see alignment E=6.2e-153

Best Hits

Swiss-Prot: 70% identical to YAAJ_ECOLI: Uncharacterized transporter YaaJ (yaaJ) from Escherichia coli (strain K12)

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 88% identity to enc:ECL_00820)

Predicted SEED Role

"Putative alanine/glycine transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (476 amino acids)

>EX28DRAFT_3619 amino acid carrier protein (Enterobacter asburiae PDN3)
MPDFFFFINEVLWGSIMIYLLLGAGIWFTLRSGFIQFRYIRKFGRSLKNSVTPQPGGLTS
FQALCTSLAARLGSGNLAGVALAISAGGPGAVFWMWVTALLGMATSFAESSLAQLYKEKD
KNGQFRGGPAWYMARGLGMRWMGVLFSLFLLLAYGLIFNTVQANSVANALRYAFSCPEWI
AGIVLALVVLLTISAGLRGIARLMQWLVPVMALLWVAASLFVAALHIDQVPGVITTIVKS
AFGWREVASGALGYTFSQALMAGFQRGMFSNEAGMGSTPNAAAAASSWPPHPAAQGIVQM
IGVFTDTIIICSASAMILLLAGPVPHSSGTAGIQLLQQALVNLTGGWGAGFVSLILVLFA
FSSIVVNYLYAENNLIFLKLDSRAAIGTLRLAVILMIIAGSFLSMPLVWQLADIIMALMA
ITNLTAILLLSPVVTLIARDYLRQRNLGVPPVFDPARYPDVKAQLAPGTWDDLPRQ