Protein Info for EX28DRAFT_3602 in Enterobacter asburiae PDN3

Annotation: Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 645 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF14718: SLT_L" amino acids 407 to 472 (66 residues), 83.2 bits, see alignment E=1.8e-27 PF01464: SLT" amino acids 483 to 596 (114 residues), 120.6 bits, see alignment E=4.2e-39 PF27553: SLT_superhelical" amino acids 605 to 632 (28 residues), 63.7 bits, see alignment (E = 1.6e-21)

Best Hits

Swiss-Prot: 87% identical to SLT_ECOLI: Soluble lytic murein transglycosylase (slt) from Escherichia coli (strain K12)

KEGG orthology group: K08309, soluble lytic murein transglycosylase [EC: 3.2.1.-] (inferred from 98% identity to enc:ECL_00805)

MetaCyc: 87% identical to soluble lytic murein transglycosylase (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]; 4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.- or 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (645 amino acids)

>EX28DRAFT_3602 Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) (Enterobacter asburiae PDN3)
MEKAKRVVWRLLAASVCVMAVSQAVHADSLDEQRNRYAQIKQAWDNKQMDTVQALMPTLK
DYPLYPYLEYRQITDDLMNQPTVTVNNFIQANPTLPPARNLQSRFVNELARREDWRGLLA
FSPEKPNATEAQCNYYYAKWATGQQEEAWAGAKELWLTGKNQPNACDSLFSAWRASGKQD
PLSYLERIRLAMKAGNTRLVTTLAGQMPSDYQTISTAVISLANDPNSVLTFARSTGATDF
TRQMAAVAFASVARDDVENARLMIPQLVQAQQLNEEQTQELRDIVAWRLMGTDVTDEQAR
WRDDAIMRSNSTSLVERRVRMALGTGDRRGLNTWLARLPMEAKEKDEWRYWQADLLMERG
RDDEAKEILHTLMQQRGFYPMAAAQRLGEEYTFRIDKAPANANPALTQGPEMARVRELMY
WNMDNTARSEWANLVTSRTTDEKAQLARYAFDNHWWDLSVQATIAGKLWDHLEERFPLAY
KDLFDRYTSGKDIPQSYAMAIARQESAWNPKVRSPVGASGLMQIMPGTATHTVKMFNIPG
YSSPSQLLDPDTNINIGTSYLQYVYQQFGNNRIFSSAAYNAGPGRVRTWLGNSAGRIDAV
AFVESIPFSETRGYVKNVLAYDAYYRYFMGQKDTLMSDAEWQRRY