Protein Info for EX28DRAFT_3573 in Enterobacter asburiae PDN3

Annotation: diguanylate cyclase (GGDEF) domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 42 to 62 (21 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 123 to 138 (16 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 187 to 347 (161 residues), 161.1 bits, see alignment E=1e-51 PF00990: GGDEF" amino acids 190 to 344 (155 residues), 163.1 bits, see alignment E=2.3e-52

Best Hits

KEGG orthology group: None (inferred from 88% identity to enc:ECL_00780)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>EX28DRAFT_3573 diguanylate cyclase (GGDEF) domain (Enterobacter asburiae PDN3)
MTSQSWRSLVHRKYQLSLRLFLFLNATSAVFSVTNPLNSVRLLSAPLIAIFSISTGLFVW
HWRKRARKINIPVVSGIFGILWAWQIVSKFALITHDHATYLLIALLTVLFIGTLAFASNI
KAFTLHSLPTFIVCLWLSDHDIWLRMTYSFALPVVAIAIHNILQTRNDRFAQELLSRLLE
ERETLTDLSMMDPLTGLYNRRGLQSRLENLPTVENGEHFVLLMDIDHFKAYNDHYGHMMG
DQALKRVSAAIRDAVRSRDIVARFGGEEFMVLLTNISLEHARQTAERIRQKVYDLKIPHL
FNESVATNVTISIGIAIFEDEDVEGALEKADKALYEAKHMGRNNILLSEELQTA