Protein Info for EX28DRAFT_3548 in Enterobacter asburiae PDN3

Annotation: homoprotocatechuate degradation operon regulator, HpaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR02337: homoprotocatechuate degradation operon regulator, HpaR" amino acids 4 to 133 (130 residues), 191.6 bits, see alignment E=2.2e-61 PF12802: MarR_2" amino acids 27 to 85 (59 residues), 35.2 bits, see alignment E=1.8e-12 PF01047: MarR" amino acids 29 to 86 (58 residues), 54.1 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 87% identical to HPCR_ECOLX: Homoprotocatechuate degradative operon repressor (hpcR) from Escherichia coli

KEGG orthology group: None (inferred from 99% identity to enc:ECL_00759)

Predicted SEED Role

"Homoprotocatechuate degradative operon repressor" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>EX28DRAFT_3548 homoprotocatechuate degradation operon regulator, HpaR (Enterobacter asburiae PDN3)
MHDSLTIALLQAREAAMSYFRPIVKRHNLTEQQWRIVRVLAEHPSMDFHDLAFRTCILRP
SLTGILTRMERDGLVLRLKPVNDQRKLYVSLTKEGNALYEHAQAQVEEAYQQIEAEYTPE
KMKQLTALLEEFIELGNRHNAAREEE