Protein Info for EX28DRAFT_3422 in Enterobacter asburiae PDN3

Annotation: Predicted Zn-dependent proteases and their inactivated homologs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF01523: PmbA_TldD_1st" amino acids 36 to 100 (65 residues), 50.5 bits, see alignment E=2.8e-17 PF19290: PmbA_TldD_2nd" amino acids 128 to 234 (107 residues), 71.7 bits, see alignment E=9.9e-24 PF19289: PmbA_TldD_3rd" amino acids 242 to 449 (208 residues), 241.8 bits, see alignment E=7.1e-76

Best Hits

Swiss-Prot: 96% identical to PMBA_ECOLI: Metalloprotease PmbA (pmbA) from Escherichia coli (strain K12)

KEGG orthology group: K03592, PmbA protein (inferred from 99% identity to enc:ECL_00640)

MetaCyc: 96% identical to metalloprotease subunit TldE (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldE protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (450 amino acids)

>EX28DRAFT_3422 Predicted Zn-dependent proteases and their inactivated homologs (Enterobacter asburiae PDN3)
MAFAMKVTSQVEAQRKILEEAVSTALMLASEKSDGAEVAVSKTTGISVSTRYGEVENVEF
NSDGALGITVYHQNRKGSASSTDLSPDAIARTVQAALDIARYTSPDPYAGVADKDLLAFD
APDLDLFHPAEVTPDEAIELAARAEQASLQADKRITNTEGGSFNSHYGIKVFGNSHGMLQ
GYCSTRHSLSSCVIAEENGDMERDYAYTIGRALGDLQSPEWVGKECAERTLSRLSPRKLS
TMKAPVIFANEVATGLFGHLVGAIAGGSVYRKSTFLLDSLGKQILPEWLTIEEHPHLLKG
LASTPFDSEGVRTERRDIIKDGILTQWLLTNYSARKLGLKSTGHAGGIHNWRIAGQGLNF
EQMLKEMGTGLVVTELMGQGVSGITGDYSRGAAGFWVENGEIQYPVSEITIAGNLKDMWR
NIVTVGNDIETRSNIQCGSVLLPEMKIAGQ